Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (9 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein Nedd8 [54244] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [54245] (7 PDB entries) Uniprot Q15843 |
Domain d3dbli_: 3dbl I: [157481] Other proteins in same PDB: d3dbla_, d3dblb_, d3dblc_, d3dbld_, d3dble_, d3dblf_, d3dblg_, d3dblh_ automated match to d1nddb_ complexed with zn |
PDB Entry: 3dbl (more details), 2.9 Å
SCOPe Domain Sequences for d3dbli_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dbli_ d.15.1.1 (I:) Nedd8 {Human (Homo sapiens) [TaxId: 9606]} rrasvgsggsmlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqm ndektaadykilggsvlhlvlqlrgg
Timeline for d3dbli_: