Lineage for d3dbli_ (3dbl I:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1194674Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1194675Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1194676Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1194731Protein Nedd8 [54244] (1 species)
  7. 1194732Species Human (Homo sapiens) [TaxId:9606] [54245] (7 PDB entries)
    Uniprot Q15843
  8. 1194742Domain d3dbli_: 3dbl I: [157481]
    Other proteins in same PDB: d3dbla_, d3dblb_, d3dblc_, d3dbld_, d3dble_, d3dblf_, d3dblg_, d3dblh_
    automated match to d1nddb_
    complexed with zn

Details for d3dbli_

PDB Entry: 3dbl (more details), 2.9 Å

PDB Description: structural dissection of a gating mechanism preventing misactivation of ubiquitin by nedd8's e1 (appbp1-uba3arg190wt-nedd8ala72gln)
PDB Compounds: (I:) nedd8

SCOPe Domain Sequences for d3dbli_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dbli_ d.15.1.1 (I:) Nedd8 {Human (Homo sapiens) [TaxId: 9606]}
rrasvgsggsmlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqm
ndektaadykilggsvlhlvlqlrgg

SCOPe Domain Coordinates for d3dbli_:

Click to download the PDB-style file with coordinates for d3dbli_.
(The format of our PDB-style files is described here.)

Timeline for d3dbli_: