Lineage for d3dblg_ (3dbl G:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2149982Fold c.111: Activating enzymes of the ubiquitin-like proteins [69571] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 32145678; strands 6 and 8 are antiparallel to the rest
  4. 2149983Superfamily c.111.1: Activating enzymes of the ubiquitin-like proteins [69572] (3 families) (S)
    transfer adenylyl group to the C-terminal carboxyl group of the ubiquitin and MoaD/ThiS-related proteins
    the ATP nucleotide-binding site is similar to that of the NAD-binding Rossmann-folds
  5. 2149990Family c.111.1.2: Ubiquitin activating enzymes (UBA) [89763] (3 protein domains)
    the common fold is elaborated with additional (sub)domains
  6. 2149991Protein Amyloid beta precursor protein-binding protein 1, APPBP1 [89766] (1 species)
    a subunit of the heterodimeric E1 enzyme for NEDD8; contains a large insertion (residues 170-487) that can be divided into 3 units similar to the UBA3 insertion
  7. 2149992Species Human (Homo sapiens) [TaxId:9606] [89767] (10 PDB entries)
    Uniprot Q13564
  8. 2150006Domain d3dblg_: 3dbl G: [157479]
    Other proteins in same PDB: d3dblb2, d3dblb3, d3dbld2, d3dbld3, d3dblf2, d3dblf3, d3dblh2, d3dblh3, d3dbli2, d3dbli3, d3dblj_, d3dblk_, d3dbll_
    automated match to d1tt5a_
    complexed with zn

Details for d3dblg_

PDB Entry: 3dbl (more details), 2.9 Å

PDB Description: structural dissection of a gating mechanism preventing misactivation of ubiquitin by nedd8's e1 (appbp1-uba3arg190wt-nedd8ala72gln)
PDB Compounds: (G:) NEDD8-activating enzyme E1 regulatory subunit

SCOPe Domain Sequences for d3dblg_:

Sequence, based on SEQRES records: (download)

>d3dblg_ c.111.1.2 (G:) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]}
kllkeqkydrqlrlwgdhgqealesahvclinatatgteilknlvlpgigsftiidgnqv
sgedagnnfflqrssigknraeaameflqelnsdvsgsfveespenlldndpsffcrftv
vvatqlpestslrladvlwnsqipllicrtyglvgymriiikehpvieshpdnaledlrl
dkpfpelrehfqsydldhmekkdhshtpwiviiakylaqwysetngripktykekedfrd
lirqgilkpedeenfeeaiknvntalnttqipssiedifnddrcinitkqtpsfwilara
lkefvakegqgnlpvrgtipdmiadsgkyiklqnvyrekakkdaaavgnhvakllqsigq
apesisekelkllcsnsaflrvvrcrslaeeygldtinkdeiissmdnpdneivlylmlr
avdrfhkqqgrypgvsnyqveedigklkscltgflqeyglsvmvkddyvhefcrygaaep
htiaaflggaaaqevikiitkqfvifnntyiysgmsqtsatfql

Sequence, based on observed residues (ATOM records): (download)

>d3dblg_ c.111.1.2 (G:) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]}
kllkeqkydrqlrlwgdhgqealesahvclinatatgteilknlvlpgigsftiidgnqv
sgedagnnfflqrssigknraeaameflqelnsdvsgsfveespenlldndpsffcrftv
vvatqlpestslrladvlwnsqipllicrtyglvgymriiikehpvieshpdnaledlrl
dkpfpelrehfqsydldhdhshtpwiviiakylaqwysetngripktykekedfrdlirq
gilkdeenfeeaiknvntalnttqipssiedifnddrcinitkqtpsfwilaralkefva
kegqgnlpvrgtipdmiadsgkyiklqnvyrekakkdaaavgnhvakllqsigqapesis
ekelkllcsnsaflrvvrcrslaeeygldtinkdeiissmdnpdneivlylmlravdrfh
kqqgrypgvsnyqveedigklkscltgflqeyglsvmvkddyvhefcrygaaephtiaaf
lggaaaqevikiitkqfvifnntyiysgmsqtsatfql

SCOPe Domain Coordinates for d3dblg_:

Click to download the PDB-style file with coordinates for d3dblg_.
(The format of our PDB-style files is described here.)

Timeline for d3dblg_: