Lineage for d3dblb2 (3dbl B:12-442)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921020Fold c.111: Activating enzymes of the ubiquitin-like proteins [69571] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 32145678; strands 6 and 8 are antiparallel to the rest
  4. 2921021Superfamily c.111.1: Activating enzymes of the ubiquitin-like proteins [69572] (3 families) (S)
    transfer adenylyl group to the C-terminal carboxyl group of the ubiquitin and MoaD/ThiS-related proteins
    the ATP nucleotide-binding site is similar to that of the NAD-binding Rossmann-folds
  5. 2921028Family c.111.1.2: Ubiquitin activating enzymes (UBA) [89763] (3 proteins)
    the common fold is elaborated with additional (sub)domains
  6. 2921060Protein UBA3 [89764] (1 species)
    a subunit of the heterodimeric E1 enzyme for NEDD8; contains an all-alpha insert subdomain of the FF-like fold (residues 210-288) and an extra C-terminal alpha+beta subdomain (partly disordered)
  7. 2921061Species Human (Homo sapiens) [TaxId:9606] [89765] (12 PDB entries)
    Uniprot Q8TBC4 33-458
  8. 2921071Domain d3dblb2: 3dbl B:12-442 [157474]
    Other proteins in same PDB: d3dbla_, d3dblb3, d3dblc_, d3dbld3, d3dble_, d3dblf3, d3dblg_, d3dblh3, d3dbli2, d3dbli3, d3dblj_, d3dblk_, d3dbll_
    automated match to d1r4mb_
    complexed with zn

    has additional subdomain(s) that are not in the common domain

Details for d3dblb2

PDB Entry: 3dbl (more details), 2.9 Å

PDB Description: structural dissection of a gating mechanism preventing misactivation of ubiquitin by nedd8's e1 (appbp1-uba3arg190wt-nedd8ala72gln)
PDB Compounds: (B:) NEDD8-activating enzyme E1 catalytic subunit

SCOPe Domain Sequences for d3dblb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dblb2 c.111.1.2 (B:12-442) UBA3 {Human (Homo sapiens) [TaxId: 9606]}
dwegrwnhvkkflersgpfthpdfepsteslqflldtckvlvigagglgcellknlalsg
frqihvidmdtidvsnlnrqflfrpkdigrpkaevaaeflndrvpncnvvphfnkiqdfn
dtfyrqfhiivcgldsiiarrwingmlisllnyedgvldpssivplidggtegfkgnarv
ilpgmtaciectlelyppqvnfpmatiasmprlpehcieyvrmlqwpkeqpfgegvpldg
ddpehiqwifqkslerasqynirgvtyrltqgvvkriipavastnaviaavcatevfkia
tsayiplnnylvfndvdglytytfeaerkencpacsqlpqniqfspsaklqevldyltns
aslqmkspaitatlegknrtlylqsvtsieertrpnlsktlkelglvdgqelavadvttp
qtvlfklhfts

SCOPe Domain Coordinates for d3dblb2:

Click to download the PDB-style file with coordinates for d3dblb2.
(The format of our PDB-style files is described here.)

Timeline for d3dblb2: