SCOPe 2.08: Domain d3dbhi2: 3dbh I:101-176

Lineage for d3dbhi2 (3dbh I:101-176)

Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
Superfamily d.15.1: Ubiquitin-like [54236] (11 families)
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
Pfam PF00240
Protein Nedd8 [54244] (1 species)
Species Human (Homo sapiens) [TaxId:9606] [54245] (16 PDB entries)
Uniprot Q15843

Domain d3dbhi2: 3dbh I:101-176 [157472]
Other proteins in same PDB: d3dbha_, d3dbhb1, d3dbhb2, d3dbhc_, d3dbhd1, d3dbhd2, d3dbhe_, d3dbhf1, d3dbhf2, d3dbhg_, d3dbhh1, d3dbhh2, d3dbhi3
automated match to d1nddb_
complexed with zn

Details for d3dbhi2

PDB Entry: 3dbh (more details), 2.85 Å

PDB Description: structural dissection of a gating mechanism preventing misactivation of ubiquitin by nedd8's e1 (appbp1-uba3arg190ala-nedd8ala72arg)

PDB Compounds: (I:) nedd8

SCOPe Domain Sequences for d3dbhi2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dbhi2 d.15.1.1 (I:101-176) Nedd8 {Human (Homo sapiens) [TaxId: 9606]}
mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk
ilggsvlhlvlrlrgg

SCOPe Domain Coordinates for d3dbhi2:

Click to download the PDB-style file with coordinates for d3dbhi2.
(The format of our PDB-style files is described here.)

Timeline for d3dbhi2: