Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein Fibroblast growth factor receptor, FGFR [49179] (4 species) |
Species Human (Homo sapiens), FGFR2a [TaxId:9606] [49181] (10 PDB entries) |
Domain d3darb_: 3dar B: [157467] automated match to d3cafa_ |
PDB Entry: 3dar (more details), 2.2 Å
SCOPe Domain Sequences for d3darb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3darb_ b.1.1.4 (B:) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} krapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykvr nqhwslimesvvpsdkgnytcvveneygsinhtyhldvv
Timeline for d3darb_: