SCOP 1.75: Domain d3darb1: 3dar B:153-249

Lineage for d3darb1 (3dar B:153-249)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.4: I set domains [49159] (38 proteins)

6. Protein Fibroblast growth factor receptor, FGFR [49179] (4 species)

7. Species Human (Homo sapiens), FGFR2a [TaxId:9606] [49181] (7 PDB entries)

8. Domain d3darb1: 3dar B:153-249 [157467]
   automatically matched to d1djsa1

Details for d3darb1

PDB Entry: 3dar, 2.2 Å

PDB Description: Crystal structure of D2 domain from human FGFR2

PDB Compounds: (B:) Fibroblast growth factor receptor 2

SCOP Domain Sequences for d3darb1:

Sequence; same for both SEQRES and ATOM records:

>d3darb1 b.1.1.4 (B:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]}
apywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykvrnq
hwslimesvvpsdkgnytcvveneygsinhtyhldvv

Timeline for d3darb1:

• d3darb1 is new in SCOP 1.75
  
• d3darb1 appears in SCOPe 2.01
  
• d3darb1 appears in the current release, SCOPe 2.08, called d3darb_