| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.4: I set domains [49159] (39 proteins) |
| Protein Fibroblast growth factor receptor, FGFR [49179] (4 species) |
| Species Human (Homo sapiens), FGFR2a [TaxId:9606] [49181] (10 PDB entries) |
| Domain d3dara1: 3dar A:153-249 [157466] automatically matched to d1djsa1 |
PDB Entry: 3dar (more details), 2.2 Å
SCOPe Domain Sequences for d3dara1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]}
apywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykvrnq
hwslimesvvpsdkgnytcvveneygsinhtyhldvv
Timeline for d3dara1: