Lineage for d3d9ta1 (3d9t A:260-346)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038051Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 3038052Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) (S)
  5. 3038053Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 3038054Protein 2MIHB/C-IAP-1 [57926] (1 species)
    baculoviral inhibitor of apoptosis
  7. 3038055Species Human (Homo sapiens) [TaxId:9606] [57927] (6 PDB entries)
  8. 3038056Domain d3d9ta1: 3d9t A:260-346 [157463]
    Other proteins in same PDB: d3d9tb2
    automatically matched to d1qbha_
    complexed with zn

Details for d3d9ta1

PDB Entry: 3d9t (more details), 1.5 Å

PDB Description: CIAP1-BIR3 in complex with N-terminal peptide from Caspase-9 (ATPFQE)
PDB Compounds: (A:) Baculoviral IAP repeat-containing protein 2

SCOPe Domain Sequences for d3d9ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d9ta1 g.52.1.1 (A:260-346) 2MIHB/C-IAP-1 {Human (Homo sapiens) [TaxId: 9606]}
mqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwesgddpwve
hakwfprceflirmkgqefvdeiqgry

SCOPe Domain Coordinates for d3d9ta1:

Click to download the PDB-style file with coordinates for d3d9ta1.
(The format of our PDB-style files is described here.)

Timeline for d3d9ta1: