![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily) metal(zinc)-bound alpha+beta fold |
![]() | Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) ![]() |
![]() | Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins) |
![]() | Protein 2MIHB/C-IAP-1 [57926] (1 species) baculoviral inhibitor of apoptosis |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57927] (6 PDB entries) |
![]() | Domain d3d9ta1: 3d9t A:260-346 [157463] Other proteins in same PDB: d3d9tb2 automatically matched to d1qbha_ complexed with zn |
PDB Entry: 3d9t (more details), 1.5 Å
SCOPe Domain Sequences for d3d9ta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d9ta1 g.52.1.1 (A:260-346) 2MIHB/C-IAP-1 {Human (Homo sapiens) [TaxId: 9606]} mqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwesgddpwve hakwfprceflirmkgqefvdeiqgry
Timeline for d3d9ta1: