SCOPe 2.05: Domain d3d9rd_: 3d9r D:

Lineage for d3d9rd_ (3d9r D:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.27: ECA1476-like [160033] (1 protein)
   single domain covered by PfamB PB006272 in the N-terminal part and PfamB PB005262 in the C-terminal part

6. Protein Uncharacterized protein ECA1476 [160034] (1 species)

7. Species Pectobacterium atrosepticum [TaxId:29471] [160035] (1 PDB entry)
   Uniprot Q6D750 3-134

8. Domain d3d9rd_: 3d9r D: [157462]
   automated match to d3d9ra1
   complexed with gol, na, unl

Details for d3d9rd_

PDB Entry: 3d9r, 2.4 Å

PDB Description: crystal structure of ketosteroid isomerase-like protein (yp_049581.1) from erwinia carotovora atroseptica scri1043 at 2.40 a resolution

PDB Compounds: (D:) ketosteroid isomerase-like protein

SCOPe Domain Sequences for d3d9rd_:

Sequence; same for both SEQRES and ATOM records:

>d3d9rd_ d.17.4.27 (D:) Uncharacterized protein ECA1476 {Pectobacterium atrosepticum [TaxId: 29471]}
fneelavieaaaiayltafnradipaviatytddgvlmgpgrpaavgkdelaevylsvfe
tvgfdmayeikevvqtsadwafvrsategtetnkatgvvtpaayqelfllrksatgswqt
aryctskisp

Timeline for d3d9rd_:

• d3d9rd_ first appeared in SCOP 1.75, called d3d9rd1
  
• d3d9rd_ appears in SCOPe 2.04
  
• d3d9rd_ appears in SCOPe 2.06
  
• d3d9rd_ appears in the current release, SCOPe 2.08