Lineage for d3d9rc_ (3d9r C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936287Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2937140Family d.17.4.27: ECA1476-like [160033] (1 protein)
    single domain covered by PfamB PB006272 in the N-terminal part and PfamB PB005262 in the C-terminal part
  6. 2937141Protein Uncharacterized protein ECA1476 [160034] (1 species)
  7. 2937142Species Pectobacterium atrosepticum [TaxId:29471] [160035] (1 PDB entry)
    Uniprot Q6D750 3-134
  8. 2937145Domain d3d9rc_: 3d9r C: [157461]
    automated match to d3d9ra1
    complexed with gol, na, unl

Details for d3d9rc_

PDB Entry: 3d9r (more details), 2.4 Å

PDB Description: crystal structure of ketosteroid isomerase-like protein (yp_049581.1) from erwinia carotovora atroseptica scri1043 at 2.40 a resolution
PDB Compounds: (C:) ketosteroid isomerase-like protein

SCOPe Domain Sequences for d3d9rc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d9rc_ d.17.4.27 (C:) Uncharacterized protein ECA1476 {Pectobacterium atrosepticum [TaxId: 29471]}
mskifneelavieaaaiayltafnradipaviatytddgvlmgpgrpaavgkdelaevyl
svfetvgfdmayeikevvqtsadwafvrsategtetnkatgvvtpaayqelfllrksatg
swqtaryctskisp

SCOPe Domain Coordinates for d3d9rc_:

Click to download the PDB-style file with coordinates for d3d9rc_.
(The format of our PDB-style files is described here.)

Timeline for d3d9rc_: