![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
![]() | Family d.17.4.27: ECA1476-like [160033] (1 protein) single domain covered by PfamB PB006272 in the N-terminal part and PfamB PB005262 in the C-terminal part |
![]() | Protein Uncharacterized protein ECA1476 [160034] (1 species) |
![]() | Species Pectobacterium atrosepticum [TaxId:29471] [160035] (1 PDB entry) Uniprot Q6D750 3-134 |
![]() | Domain d3d9rc_: 3d9r C: [157461] automated match to d3d9ra1 complexed with gol, na, unl |
PDB Entry: 3d9r (more details), 2.4 Å
SCOPe Domain Sequences for d3d9rc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d9rc_ d.17.4.27 (C:) Uncharacterized protein ECA1476 {Pectobacterium atrosepticum [TaxId: 29471]} mskifneelavieaaaiayltafnradipaviatytddgvlmgpgrpaavgkdelaevyl svfetvgfdmayeikevvqtsadwafvrsategtetnkatgvvtpaayqelfllrksatg swqtaryctskisp
Timeline for d3d9rc_: