Lineage for d3d8ag_ (3d8a G:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2738088Fold a.241: TraM-like [140580] (1 superfamily)
    multihelical oligomeric protein; structure of whole subunit is not known; the N-terminal part is implicated in DNA binding, the middle region forms tetrameric parallel coiled coil, surrounded by the C-terminal helices
  4. 2738089Superfamily a.241.1: TraM-like [140581] (1 family) (S)
    automatically mapped to Pfam PF05261
  5. 2738090Family a.241.1.1: TraM-like [140582] (1 protein)
    Pfam PF05261
  6. 2738091Protein TraM [140583] (2 species)
    also includes the N-terminal domain structure 1dp3, previously classified into a different family (63566)
  7. 2738092Species Escherichia coli K-12 [TaxId:83333] [158509] (1 PDB entry)
  8. 2738099Domain d3d8ag_: 3d8a G: [157454]
    automated match to d2g7oa1
    protein/DNA complex

Details for d3d8ag_

PDB Entry: 3d8a (more details), 2.55 Å

PDB Description: co-crystal structure of tram-trad complex.
PDB Compounds: (G:) Relaxosome protein TraM

SCOPe Domain Sequences for d3d8ag_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d8ag_ a.241.1.1 (G:) TraM {Escherichia coli K-12 [TaxId: 83333]}
afnqtefnklllecvvktqssvakilgieslsphvsgnskfeyanmvedirekvssemer
ffp

SCOPe Domain Coordinates for d3d8ag_:

Click to download the PDB-style file with coordinates for d3d8ag_.
(The format of our PDB-style files is described here.)

Timeline for d3d8ag_: