SCOP 1.75: Domain d3d8ac1: 3d8a C:60-122

Lineage for d3d8ac1 (3d8a C:60-122)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.241: TraM-like [140580] (1 superfamily)
   multihelical oligomeric protein; structure of whole subunit is not known; the N-terminal part is implicated in DNA binding, the middle region forms tetrameric parallel coiled coil, surrounded by the C-terminal helices

4. Superfamily a.241.1: TraM-like [140581] (1 family)

5. Family a.241.1.1: TraM-like [140582] (1 protein)
   Pfam PF05261

6. Protein TraM [140583] (2 species)
   also includes the N-terminal domain structure 1dp3, previously classified into a different family ((63566))
   also includes the N-terminal domain structure 1dp3, previously classified into a different family ((63566))

7. Species Escherichia coli K12 (Escherichia coli K-12) [TaxId:83333] [158509] (1 PDB entry)

8. Domain d3d8ac1: 3d8a C:60-122 [157450]
   automatically matched to d2g7oa1

Details for d3d8ac1

PDB Entry: 3d8a, 2.55 Å

PDB Description: co-crystal structure of tram-trad complex.

PDB Compounds: (C:) Protein traM

SCOP Domain Sequences for d3d8ac1:

Sequence; same for both SEQRES and ATOM records:

>d3d8ac1 a.241.1.1 (C:60-122) TraM {Escherichia coli K12 (Escherichia coli K-12) [TaxId: 83333]}
afnqtefnklllecvvktqssvakilgieslsphvsgnskfeyanmvedirekvssemer
ffp

Timeline for d3d8ac1:

• d3d8ac1 is new in SCOP 1.75
  
• d3d8ac1 is called d3d8ac_ in SCOPe 2.01
  
• d3d8ac1 appears in the current release, SCOPe 2.08, called d3d8ac_