Class a: All alpha proteins [46456] (284 folds) |
Fold a.241: TraM-like [140580] (1 superfamily) multihelical oligomeric protein; structure of whole subunit is not known; the N-terminal part is implicated in DNA binding, the middle region forms tetrameric parallel coiled coil, surrounded by the C-terminal helices |
Superfamily a.241.1: TraM-like [140581] (1 family) |
Family a.241.1.1: TraM-like [140582] (1 protein) Pfam PF05261 |
Protein TraM [140583] (2 species) also includes the N-terminal domain structure 1dp3, previously classified into a different family ((63566)) also includes the N-terminal domain structure 1dp3, previously classified into a different family ((63566)) |
Species Escherichia coli K12 (Escherichia coli K-12) [TaxId:83333] [158509] (1 PDB entry) |
Domain d3d8ac1: 3d8a C:60-122 [157450] automatically matched to d2g7oa1 |
PDB Entry: 3d8a (more details), 2.55 Å
SCOP Domain Sequences for d3d8ac1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d8ac1 a.241.1.1 (C:60-122) TraM {Escherichia coli K12 (Escherichia coli K-12) [TaxId: 83333]} afnqtefnklllecvvktqssvakilgieslsphvsgnskfeyanmvedirekvssemer ffp
Timeline for d3d8ac1: