Class a: All alpha proteins [46456] (289 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) automatically mapped to Pfam PF00081 |
Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins) |
Protein Fe superoxide dismutase (FeSOD) [46611] (10 species) |
Species Sulfolobus acidocaldarius [TaxId:2285] [46617] (1 PDB entry) |
Domain d1b06f1: 1b06 F:3-92 [15745] Other proteins in same PDB: d1b06a2, d1b06b2, d1b06c2, d1b06d2, d1b06e2, d1b06f2 complexed with fe |
PDB Entry: 1b06 (more details), 2.2 Å
SCOPe Domain Sequences for d1b06f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b06f1 a.2.11.1 (F:3-92) Fe superoxide dismutase (FeSOD) {Sulfolobus acidocaldarius [TaxId: 2285]} viqlkryefpqlpykvdalepyiskdiidvhynghhkgyvnganslldrleklikgdlpq gqydlqgilrgltfninghklhaiywnnma
Timeline for d1b06f1: