Class a: All alpha proteins [46456] (290 folds) |
Fold a.241: TraM-like [140580] (1 superfamily) multihelical oligomeric protein; structure of whole subunit is not known; the N-terminal part is implicated in DNA binding, the middle region forms tetrameric parallel coiled coil, surrounded by the C-terminal helices |
Superfamily a.241.1: TraM-like [140581] (1 family) automatically mapped to Pfam PF05261 |
Family a.241.1.1: TraM-like [140582] (1 protein) Pfam PF05261 |
Protein TraM [140583] (2 species) also includes the N-terminal domain structure 1dp3, previously classified into a different family (63566) |
Species Escherichia coli K-12 [TaxId:83333] [158509] (1 PDB entry) |
Domain d3d8ab_: 3d8a B: [157449] automated match to d2g7oa1 protein/DNA complex |
PDB Entry: 3d8a (more details), 2.55 Å
SCOPe Domain Sequences for d3d8ab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d8ab_ a.241.1.1 (B:) TraM {Escherichia coli K-12 [TaxId: 83333]} afnqtefnklllecvvktqssvakilgieslsphvsgnskfeyanmvedirekvssemer ffp
Timeline for d3d8ab_: