Lineage for d3d87d1 (3d87 D:1-87)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 787055Family b.1.1.4: I set domains [49159] (38 proteins)
  6. 787390Protein The p40 domain of interleukin-12 (IL-12 beta chain), N-terminal domain [63665] (1 species)
  7. 787391Species Human (Homo sapiens) [TaxId:9606] [63666] (5 PDB entries)
  8. 787398Domain d3d87d1: 3d87 D:1-87 [157445]
    Other proteins in same PDB: d3d87b2, d3d87b3, d3d87d2, d3d87d3
    automatically matched to d1f42a1
    complexed with k, man, po4; mutant

Details for d3d87d1

PDB Entry: 3d87 (more details), 2.9 Å

PDB Description: crystal structure of interleukin-23
PDB Compounds: (D:) Interleukin-12 subunit p40

SCOP Domain Sequences for d3d87d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d87d1 b.1.1.4 (D:1-87) The p40 domain of interleukin-12 (IL-12 beta chain), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
iwelkkdvyvveldwypdapgemvvltcdtpeedgitwtldqssevlgsgktltiqvkef
gdagqytchkggevlshsllllhkked

SCOP Domain Coordinates for d3d87d1:

Click to download the PDB-style file with coordinates for d3d87d1.
(The format of our PDB-style files is described here.)

Timeline for d3d87d1: