| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.4: I set domains [49159] (38 proteins) |
| Protein The p40 domain of interleukin-12 (IL-12 beta chain), N-terminal domain [63665] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [63666] (5 PDB entries) |
| Domain d3d87d1: 3d87 D:1-87 [157445] Other proteins in same PDB: d3d87b2, d3d87b3, d3d87d2, d3d87d3 automatically matched to d1f42a1 complexed with k, man, po4; mutant |
PDB Entry: 3d87 (more details), 2.9 Å
SCOP Domain Sequences for d3d87d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d87d1 b.1.1.4 (D:1-87) The p40 domain of interleukin-12 (IL-12 beta chain), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
iwelkkdvyvveldwypdapgemvvltcdtpeedgitwtldqssevlgsgktltiqvkef
gdagqytchkggevlshsllllhkked
Timeline for d3d87d1: