Lineage for d3d85d3 (3d85 D:212-305)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1521239Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 1521240Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 1521676Protein The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 [63672] (1 species)
  7. 1521677Species Human (Homo sapiens) [TaxId:9606] [63673] (5 PDB entries)
  8. 1521679Domain d3d85d3: 3d85 D:212-305 [157441]
    Other proteins in same PDB: d3d85a1, d3d85a2, d3d85d1
    automatically matched to d1f42a3
    complexed with imd, mpd

Details for d3d85d3

PDB Entry: 3d85 (more details), 1.9 Å

PDB Description: crystal structure of il-23 in complex with neutralizing fab
PDB Compounds: (D:) Interleukin-12 subunit p40

SCOPe Domain Sequences for d3d85d3:

Sequence, based on SEQRES records: (download)

>d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]}
kpdppknlqlkplknsrqvevsweypdtwstphsyfsltfcvqvqgkskrekkdrvftdk
tsatvicrknasisvraqdryyssswsewasvpc

Sequence, based on observed residues (ATOM records): (download)

>d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]}
kpdppknlqlkplqvevsweypdtwstphsyfsltfcvqvqgkdrvftdktsatvicrkn
asisvraqdryyssswsewasvpc

SCOPe Domain Coordinates for d3d85d3:

Click to download the PDB-style file with coordinates for d3d85d3.
(The format of our PDB-style files is described here.)

Timeline for d3d85d3: