Lineage for d3d85d2 (3d85 D:88-211)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 787437Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 787438Family b.1.2.1: Fibronectin type III [49266] (44 proteins)
    Pfam PF00041
  6. 787861Protein The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 [63672] (1 species)
  7. 787862Species Human (Homo sapiens) [TaxId:9606] [63673] (5 PDB entries)
  8. 787863Domain d3d85d2: 3d85 D:88-211 [157440]
    Other proteins in same PDB: d3d85d1
    automatically matched to d1f42a2
    complexed with imd, mpd; mutant

Details for d3d85d2

PDB Entry: 3d85 (more details), 1.9 Å

PDB Description: Crystal structure of IL-23 in complex with neutralizing FAB
PDB Compounds: (D:) Interleukin-12 subunit p40

SCOP Domain Sequences for d3d85d2:

Sequence, based on SEQRES records: (download)

>d3d85d2 b.1.2.1 (D:88-211) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]}
giwstdilkdqkepknktflrceaknysgrftcwwlttistdltfsvkssrgssdpqgvt
cgaatlsaervrgdnkeyeysvecqedsacpaaeeslpievmvdavhklkyeqytssffi
rdii

Sequence, based on observed residues (ATOM records): (download)

>d3d85d2 b.1.2.1 (D:88-211) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]}
giwstdilkdqknktflrceaknysgrftcwwlttistdltfsvkssrgssdpqgvtcga
atlsaervrnkeyeysvecqedsacpaaeeslpievmvdavhklkyeqytssffirdii

SCOP Domain Coordinates for d3d85d2:

Click to download the PDB-style file with coordinates for d3d85d2.
(The format of our PDB-style files is described here.)

Timeline for d3d85d2: