Lineage for d1b06e1 (1b06 E:3-92)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 811Fold a.2: Long alpha-hairpin [46556] (11 superfamilies)
  4. 895Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) (S)
  5. 896Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)
  6. 916Protein Fe superoxide dismutase (FeSOD) [46611] (6 species)
  7. 937Species Sulfolobus acidocaldarius [TaxId:330779] [46617] (1 PDB entry)
  8. 942Domain d1b06e1: 1b06 E:3-92 [15744]
    Other proteins in same PDB: d1b06a2, d1b06b2, d1b06c2, d1b06d2, d1b06e2, d1b06f2

Details for d1b06e1

PDB Entry: 1b06 (more details), 2.2 Å

PDB Description: superoxide dismutase from sulfolobus acidocaldarius

SCOP Domain Sequences for d1b06e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b06e1 a.2.11.1 (E:3-92) Fe superoxide dismutase (FeSOD) {Sulfolobus acidocaldarius}
viqlkryefpqlpykvdalepyiskdiidvhynghhkgyvnganslldrleklikgdlpq
gqydlqgilrgltfninghklhaiywnnma

SCOP Domain Coordinates for d1b06e1:

Click to download the PDB-style file with coordinates for d1b06e1.
(The format of our PDB-style files is described here.)

Timeline for d1b06e1: