SCOPe 2.08: Domain d3d7wb2: 3d7w B:385-510

Lineage for d3d7wb2 (3d7w B:385-510)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (4 families)

5. Family b.42.2.1: Ricin B-like [50371] (11 proteins)

6. Protein automated matches [190608] (4 species)
   not a true protein

7. Species European mistletoe (Viscum album) [TaxId:3972] [225471] (7 PDB entries)

8. Domain d3d7wb2: 3d7w B:385-510 [157435]
   Other proteins in same PDB: d3d7wa_
   automated match to d1sz6b2
   complexed with gol, nag, so4, zea, zez

Details for d3d7wb2

PDB Entry: 3d7w, 2.49 Å

PDB Description: mistletoe lectin i in complex with zeatin

PDB Compounds: (B:) Beta-galactoside-specific lectin 1

SCOPe Domain Sequences for d3d7wb2:

Sequence; same for both SEQRES and ATOM records:

>d3d7wb2 b.42.2.1 (B:385-510) automated matches {European mistletoe (Viscum album) [TaxId: 3972]}
taprettiygfrdlcmesaggsvyvetctagqenqrwalygdgsirpkqlqsqcltngrd
sistvinivscsagssgqrwvftnegailnlknglamdvaqanpslqriiiypatgnpnq
mwlpvp

Timeline for d3d7wb2:

• d3d7wb2 first appeared in SCOP 1.75
  
• d3d7wb2 appears in SCOPe 2.07