Lineage for d3d7wb1 (3d7w B:249-384)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1790651Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1791069Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 1791070Family b.42.2.1: Ricin B-like [50371] (11 proteins)
  6. 1791233Protein automated matches [190608] (3 species)
    not a true protein
  7. 1791254Species European mistletoe (Viscum album) [TaxId:3972] [225471] (5 PDB entries)
  8. 1791261Domain d3d7wb1: 3d7w B:249-384 [157434]
    Other proteins in same PDB: d3d7wa_
    automated match to d2rg9b1
    complexed with gol, nag, so4, zea, zez

Details for d3d7wb1

PDB Entry: 3d7w (more details), 2.49 Å

PDB Description: mistletoe lectin i in complex with zeatin
PDB Compounds: (B:) Beta-galactoside-specific lectin 1

SCOPe Domain Sequences for d3d7wb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d7wb1 b.42.2.1 (B:249-384) automated matches {European mistletoe (Viscum album) [TaxId: 3972]}
dvtctasepivrivgrngmtvdvrdddfhdgnqiqlwpsksnndpnqlwtikkdgtirsn
gsclttygytagvyvmifdcntavreatiwqiwgngtiinprsnlvlaassgikgttltv
qtldytlgqgwlagnd

SCOPe Domain Coordinates for d3d7wb1:

Click to download the PDB-style file with coordinates for d3d7wb1.
(The format of our PDB-style files is described here.)

Timeline for d3d7wb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3d7wb2
View in 3D
Domains from other chains:
(mouse over for more information)
d3d7wa_