Lineage for d1b06d1 (1b06 D:3-92)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins)
  6. Protein Fe superoxide dismutase (FeSOD) [46611] (10 species)
  7. Species Sulfolobus acidocaldarius [TaxId:2285] [46617] (1 PDB entry)
  8. Domain d1b06d1: 1b06 D:3-92 [15743]
    Other proteins in same PDB: d1b06a2, d1b06b2, d1b06c2, d1b06d2, d1b06e2, d1b06f2
    complexed with fe

Details for d1b06d1

PDB Entry: 1b06 (more details), 2.2 Å

PDB Description: superoxide dismutase from sulfolobus acidocaldarius
PDB Compounds: (D:) protein (superoxide dismutase)

SCOPe Domain Sequences for d1b06d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b06d1 a.2.11.1 (D:3-92) Fe superoxide dismutase (FeSOD) {Sulfolobus acidocaldarius [TaxId: 2285]}
viqlkryefpqlpykvdalepyiskdiidvhynghhkgyvnganslldrleklikgdlpq
gqydlqgilrgltfninghklhaiywnnma

SCOPe Domain Coordinates for d1b06d1 are not available.

Timeline for d1b06d1:

Domains from same chain:
(mouse over for more information)
d1b06d2
Domains from other chains:
(mouse over for more information)
d1b06a1, d1b06a2, d1b06b1, d1b06b2, d1b06c1, d1b06c2, d1b06e1, d1b06e2, d1b06f1, d1b06f2