SCOPe 2.05: Domain d3d7sb2: 3d7s B:101-153

Lineage for d3d7sb2 (3d7s B:101-153)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (2 families)
   automatically mapped to Pfam PF02748

5. Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)

6. Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (3 species)

7. Species Escherichia coli [TaxId:562] [57828] (60 PDB entries)
   Uniprot P00478

8. Domain d3d7sb2: 3d7s B:101-153 [157427]
   Other proteins in same PDB: d3d7sa1, d3d7sa2, d3d7sb1, d3d7sc1, d3d7sc2, d3d7sd1
   automated match to d1d09b2
   complexed with zn

Details for d3d7sb2

PDB Entry: 3d7s, 2.8 Å

PDB Description: Crystal structure of Wild-Type E. Coli Asparate Transcarbamoylase at pH 8.5 at 2.80 A Resolution

PDB Compounds: (B:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d3d7sb2:

Sequence; same for both SEQRES and ATOM records:

>d3d7sb2 g.41.7.1 (B:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

Timeline for d3d7sb2:

• d3d7sb2 first appeared in SCOP 1.75
  
• d3d7sb2 appears in SCOPe 2.04
  
• d3d7sb2 appears in SCOPe 2.06
  
• d3d7sb2 appears in the current release, SCOPe 2.08