SCOPe 2.08: Domain d3d7pb_: 3d7p B:

Lineage for d3d7pb_ (3d7p B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families)

5. Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
   automatically mapped to Pfam PF00576

6. Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
   sandwich; 8 strands in 2 sheets

7. Species Human (Homo sapiens) [TaxId:9606] [49475] (322 PDB entries)
   Uniprot P02766 31-143

8. Domain d3d7pb_: 3d7p B: [157423]
   automated match to d1eta1_

Details for d3d7pb_

PDB Entry: 3d7p, 1.72 Å

PDB Description: Crystal structure of human Transthyretin (TTR) at pH 4.0

PDB Compounds: (B:) Transthyretin

SCOPe Domain Sequences for d3d7pb_:

Sequence; same for both SEQRES and ATOM records:

>d3d7pb_ b.3.4.1 (B:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn

Timeline for d3d7pb_:

• d3d7pb_ first appeared in SCOP 1.75, called d3d7pb1
  
• d3d7pb_ appears in SCOPe 2.07