SCOPe 2.03: Domain d3d7ca_: 3d7c A:

Lineage for d3d7ca_ (3d7c A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.1: Bromodomain [47371] (5 proteins)

6. Protein automated matches [190366] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187201] (16 PDB entries)

8. Domain d3d7ca_: 3d7c A: [157420]
   automated match to d1f68a_

Details for d3d7ca_

PDB Entry: 3d7c, 2.06 Å

PDB Description: Crystal structure of the bromodomain of human GCN5, the general control of amino-acid synthesis protein 5-like 2

PDB Compounds: (A:) General control of amino acid synthesis protein 5-like 2

SCOPe Domain Sequences for d3d7ca_:

Sequence; same for both SEQRES and ATOM records:

>d3d7ca_ a.29.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
medpdqlyttlknllaqikshpsawpfmepvkkseapdyyevirfpidlktmterlrsry
yvtrklfvadlqrviancreynppdseycrcasalekffyfklkegglidk

Timeline for d3d7ca_:

• d3d7ca_ first appeared in SCOP 1.75, called d3d7ca1
  
• d3d7ca_ appears in SCOPe 2.02
  
• d3d7ca_ appears in SCOPe 2.04
  
• d3d7ca_ appears in the current release, SCOPe 2.08, called d3d7ca2