SCOP 1.75: Domain d3d7ca1: 3d7c A:731-832

Lineage for d3d7ca1 (3d7c A:731-832)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (1 family)

5. Family a.29.2.1: Bromodomain [47371] (4 proteins)

6. Protein GCN5 [47372] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47374] (2 PDB entries)

8. Domain d3d7ca1: 3d7c A:731-832 [157420]
   automatically matched to d1f68a_

Details for d3d7ca1

PDB Entry: 3d7c, 2.06 Å

PDB Description: Crystal structure of the bromodomain of human GCN5, the general control of amino-acid synthesis protein 5-like 2

PDB Compounds: (A:) General control of amino acid synthesis protein 5-like 2

SCOP Domain Sequences for d3d7ca1:

Sequence; same for both SEQRES and ATOM records:

>d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]}
dqlyttlknllaqikshpsawpfmepvkkseapdyyevirfpidlktmterlrsryyvtr
klfvadlqrviancreynppdseycrcasalekffyfklkeg

Timeline for d3d7ca1:

• d3d7ca1 is new in SCOP 1.75
  
• d3d7ca1 is called d3d7ca_ in SCOPe 2.01
  
• d3d7ca1 appears in the current release, SCOPe 2.08, called d3d7ca2