| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) ![]() |
| Family a.29.2.1: Bromodomain [47371] (6 proteins) |
| Protein automated matches [190366] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187201] (46 PDB entries) |
| Domain d3d7ca2: 3d7c A:729-837 [157420] Other proteins in same PDB: d3d7ca3 automated match to d1f68a_ |
PDB Entry: 3d7c (more details), 2.06 Å
SCOPe Domain Sequences for d3d7ca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d7ca2 a.29.2.1 (A:729-837) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpdqlyttlknllaqikshpsawpfmepvkkseapdyyevirfpidlktmterlrsryyv
trklfvadlqrviancreynppdseycrcasalekffyfklkegglidk
Timeline for d3d7ca2: