Lineage for d3d71a1 (3d71 A:2-120)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696351Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
    core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different
  4. 2696352Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) (S)
  5. 2696385Family a.6.1.3: DNA-binding N-terminal domain of transcription activators [46962] (5 proteins)
    includes a dimerisation, antiparallel coiled-coil subdomain
  6. 2696412Protein automated matches [232569] (1 species)
    not a true protein
  7. 2696413Species Bacillus subtilis [TaxId:1423] [232570] (4 PDB entries)
  8. 2696415Domain d3d71a1: 3d71 A:2-120 [157418]
    Other proteins in same PDB: d3d71a2
    automated match to d3iaoa1
    protein/DNA complex; complexed with etf, flc, imd, pgo, zn

Details for d3d71a1

PDB Entry: 3d71 (more details), 2.8 Å

PDB Description: crystal structure of e253q bmrr bound to 22 base pair promoter site
PDB Compounds: (A:) Multidrug-efflux transporter 1 regulator

SCOPe Domain Sequences for d3d71a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d71a1 a.6.1.3 (A:2-120) automated matches {Bacillus subtilis [TaxId: 1423]}
kesyysigevsklanvsikalryydkidlfkpayvdpdtsyryytdsqlihldlikslky
igtpleemkkaqdlemeelfafyteqerqirekldflsaleqtislvkkrmkrqmeypa

SCOPe Domain Coordinates for d3d71a1:

Click to download the PDB-style file with coordinates for d3d71a1.
(The format of our PDB-style files is described here.)

Timeline for d3d71a1: