![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.60: Probable bacterial effector-binding domain [55135] (1 superfamily) duplication of beta-alpha-beta(2) motif: antiparallel beta sheet forms barrel (n=6, S=12) |
![]() | Superfamily d.60.1: Probable bacterial effector-binding domain [55136] (5 families) ![]() |
![]() | Family d.60.1.1: Multidrug-binding domain of transcription activator BmrR [55137] (2 proteins) automatically mapped to Pfam PF06445 |
![]() | Protein Multidrug-binding domain of transcription activator BmrR [55138] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [55139] (6 PDB entries) Uniprot P39075 |
![]() | Domain d3d70a2: 3d70 A:121-276 [157417] Other proteins in same PDB: d3d70a1, d3d70a3 automatically matched to d1bowa_ protein/DNA complex; complexed with gol, imd; mutant |
PDB Entry: 3d70 (more details), 2.8 Å
SCOPe Domain Sequences for d3d70a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d70a2 d.60.1.1 (A:121-276) Multidrug-binding domain of transcription activator BmrR {Bacillus subtilis [TaxId: 1423]} lgevfvldeeeiriiqteaegigpenvlnasysklkkfiesadgftnnsygatfsfqpyt sidemtyrhiftpvltnkqissitpdmeittipkgryaciaynfspehyflnlqklikyi adrqltvvsdvyaliipihyspkkqeeyrvemkiri
Timeline for d3d70a2: