![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.60: Probable bacterial effector-binding domain [55135] (1 superfamily) duplication of beta-alpha-beta(2) motif: antiparallel beta sheet forms barrel (n=6, S=12) |
![]() | Superfamily d.60.1: Probable bacterial effector-binding domain [55136] (5 families) ![]() |
![]() | Family d.60.1.1: Multidrug-binding domain of transcription activator BmrR [55137] (2 proteins) automatically mapped to Pfam PF06445 |
![]() | Protein automated matches [232572] (1 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:1423] [232573] (4 PDB entries) |
![]() | Domain d3d6za2: 3d6z A:121-278 [157415] Other proteins in same PDB: d3d6za1 automated match to d3iaoa2 protein/DNA complex; complexed with gol, rhq; mutant |
PDB Entry: 3d6z (more details), 2.6 Å
SCOPe Domain Sequences for d3d6za2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d6za2 d.60.1.1 (A:121-278) automated matches {Bacillus subtilis [TaxId: 1423]} lgevfvldeeeiriiqteaegigpenvlnasysklkkfiesadgftnnsygatfsfqpyt sidemtyrhiftpvltnkqissitpdmeittipkgryaciaynfspehyflnlqklikyi adrqltvvsdvyeliipihyspkkqeeyrvemkieild
Timeline for d3d6za2: