Lineage for d3d6za2 (3d6z A:121-278)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2956515Fold d.60: Probable bacterial effector-binding domain [55135] (1 superfamily)
    duplication of beta-alpha-beta(2) motif: antiparallel beta sheet forms barrel (n=6, S=12)
  4. 2956516Superfamily d.60.1: Probable bacterial effector-binding domain [55136] (5 families) (S)
  5. 2956517Family d.60.1.1: Multidrug-binding domain of transcription activator BmrR [55137] (2 proteins)
    automatically mapped to Pfam PF06445
  6. 2956526Protein automated matches [232572] (1 species)
    not a true protein
  7. 2956527Species Bacillus subtilis [TaxId:1423] [232573] (4 PDB entries)
  8. 2956531Domain d3d6za2: 3d6z A:121-278 [157415]
    Other proteins in same PDB: d3d6za1
    automated match to d3iaoa2
    protein/DNA complex; complexed with gol, rhq; mutant

Details for d3d6za2

PDB Entry: 3d6z (more details), 2.6 Å

PDB Description: crystal structure of r275e mutant of bmrr bound to dna and rhodamine
PDB Compounds: (A:) Multidrug-efflux transporter 1 regulator

SCOPe Domain Sequences for d3d6za2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d6za2 d.60.1.1 (A:121-278) automated matches {Bacillus subtilis [TaxId: 1423]}
lgevfvldeeeiriiqteaegigpenvlnasysklkkfiesadgftnnsygatfsfqpyt
sidemtyrhiftpvltnkqissitpdmeittipkgryaciaynfspehyflnlqklikyi
adrqltvvsdvyeliipihyspkkqeeyrvemkieild

SCOPe Domain Coordinates for d3d6za2:

Click to download the PDB-style file with coordinates for d3d6za2.
(The format of our PDB-style files is described here.)

Timeline for d3d6za2: