SCOPe 2.08: Domain d3d6za1: 3d6z A:2-120

Lineage for d3d6za1 (3d6z A:2-120)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
   core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different

4. Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families)

5. Family a.6.1.3: DNA-binding N-terminal domain of transcription activators [46962] (5 proteins)
   includes a dimerisation, antiparallel coiled-coil subdomain

6. Protein automated matches [232569] (1 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [232570] (4 PDB entries)

8. Domain d3d6za1: 3d6z A:2-120 [157414]
   Other proteins in same PDB: d3d6za2
   automated match to d3iaoa1
   protein/DNA complex; complexed with gol, rhq; mutant

Details for d3d6za1

PDB Entry: 3d6z, 2.6 Å

PDB Description: crystal structure of r275e mutant of bmrr bound to dna and rhodamine

PDB Compounds: (A:) Multidrug-efflux transporter 1 regulator

SCOPe Domain Sequences for d3d6za1:

Sequence; same for both SEQRES and ATOM records:

>d3d6za1 a.6.1.3 (A:2-120) automated matches {Bacillus subtilis [TaxId: 1423]}
kesyysigevsklanvsikalryydkidlfkpayvdpdtsyryytdsqlihldlikslky
igtpleemkkaqdlemeelfafyteqerqirekldflsaleqtislvkkrmkrqmeypa

Timeline for d3d6za1:

• d3d6za1 first appeared in SCOP 1.75
  
• d3d6za1 appears in SCOPe 2.07