SCOP 1.75: Domain d3d5sd1: 3d5s D:11-75

Lineage for d3d5sd1 (3d5s D:11-75)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.17: Efb C-domain-like [158366] (1 family)

5. Family a.7.17.1: Efb C-domain-like [158367] (2 proteins)
   PfamB PB008033
   this is a repeat family; one repeat unit is 2gom A:105-165 found in domain

6. Protein Fibrinogen-binding protein Efb (Fib) [158368] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [158369] (4 PDB entries)
   Uniprot A6QG59 101-165! Uniprot P68798 105-165! Uniprot P68799 101-165

8. Domain d3d5sd1: 3d5s D:11-75 [157410]
   Other proteins in same PDB: d3d5sa1, d3d5sb1
   automatically matched to 3D5S C:11-75
   mutant

Details for d3d5sd1

PDB Entry: 3d5s, 2.3 Å

PDB Description: crystal structure of efb-c (r131a) / c3d complex

PDB Compounds: (D:) Fibrinogen-binding protein

SCOP Domain Sequences for d3d5sd1:

Sequence; same for both SEQRES and ATOM records:

>d3d5sd1 a.7.17.1 (D:11-75) Fibrinogen-binding protein Efb (Fib) {Staphylococcus aureus [TaxId: 1280]}
tdatikkeqkliqaqnlvrefekthtvsahakaqkavnlvsfeykvkkmvlqeridnvlk
qglvr

Timeline for d3d5sd1:

• d3d5sd1 is new in SCOP 1.75
  
• d3d5sd1 is called d3d5sd_ in SCOPe 2.01
  
• d3d5sd1 appears in the current release, SCOPe 2.08, called d3d5sd_