Lineage for d3d5rb1 (3d5r B:12-297)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 774162Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 774411Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families) (S)
  5. 774650Family a.102.4.4: Complement components [48251] (2 proteins)
    probably related to other families, but has no known enzymatic activity
  6. 774651Protein C3D, a C3 fragment and ligand for complement receptor 2 [48252] (2 species)
  7. 774652Species Human (Homo sapiens) [TaxId:9606] [48253] (6 PDB entries)
  8. 774656Domain d3d5rb1: 3d5r B:12-297 [157404]
    Other proteins in same PDB: d3d5rc1, d3d5rd1
    automatically matched to d1ghqa_
    mutant

Details for d3d5rb1

PDB Entry: 3d5r (more details), 2.1 Å

PDB Description: crystal structure of efb-c (n138a) / c3d complex
PDB Compounds: (B:) Complement C3

SCOP Domain Sequences for d3d5rb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d5rb1 a.102.4.4 (B:12-297) C3D, a C3 fragment and ligand for complement receptor 2 {Human (Homo sapiens) [TaxId: 9606]}
khlivtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelikkgytqqlafr
qpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlilekqkpdgvfqe
dapvihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsitkagdfleany
mnlqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynveatsyallal
lqlkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkda

SCOP Domain Coordinates for d3d5rb1:

Click to download the PDB-style file with coordinates for d3d5rb1.
(The format of our PDB-style files is described here.)

Timeline for d3d5rb1: