| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) ![]() automatically mapped to Pfam PF00081 |
| Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins) |
| Protein Fe superoxide dismutase (FeSOD) [46611] (10 species) |
| Species Sulfolobus acidocaldarius [TaxId:2285] [46617] (1 PDB entry) |
| Domain d1b06a1: 1b06 A:3-92 [15740] Other proteins in same PDB: d1b06a2, d1b06b2, d1b06c2, d1b06d2, d1b06e2, d1b06f2 complexed with fe |
PDB Entry: 1b06 (more details), 2.2 Å
SCOPe Domain Sequences for d1b06a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b06a1 a.2.11.1 (A:3-92) Fe superoxide dismutase (FeSOD) {Sulfolobus acidocaldarius [TaxId: 2285]}
viqlkryefpqlpykvdalepyiskdiidvhynghhkgyvnganslldrleklikgdlpq
gqydlqgilrgltfninghklhaiywnnma
Timeline for d1b06a1: