Lineage for d3d5dy1 (3d5d Y:2-101)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 946133Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 946782Superfamily b.34.5: Translation proteins SH3-like domain [50104] (7 families) (S)
    many known members contain KOW motif
  5. 946783Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)
  6. 946826Protein Ribosomal proteins L24 (L24p) [50106] (4 species)
  7. 946911Species Thermus thermophilus [TaxId:274] [159025] (11 PDB entries)
    Uniprot Q72I15 2-102
  8. 946915Domain d3d5dy1: 3d5d Y:2-101 [157395]
    Other proteins in same PDB: d3d5d61, d3d5d71, d3d5de1, d3d5dh1, d3d5dh2, d3d5dn1, d3d5do1, d3d5dp1, d3d5du1, d3d5dv1, d3d5dz1
    automatically matched to 2J01 Y:2-102
    complexed with mg

Details for d3d5dy1

PDB Entry: 3d5d (more details), 3.21 Å

PDB Description: Structural basis for translation termination on the 70S ribosome. This file contains the 50S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes as described in remark 400.
PDB Compounds: (Y:) 50S ribosomal protein L24

SCOPe Domain Sequences for d3d5dy1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d5dy1 b.34.5.1 (Y:2-101) Ribosomal proteins L24 (L24p) {Thermus thermophilus [TaxId: 274]}
rvkmhvkkgdtvlvasgkykgrvgkvkevlpkkyavivegvnivkkavrvspkypqggfi
ekeaplhaskvrpicpacgkptrvrkkflengkkirvcak

SCOPe Domain Coordinates for d3d5dy1:

Click to download the PDB-style file with coordinates for d3d5dy1.
(The format of our PDB-style files is described here.)

Timeline for d3d5dy1: