Lineage for d3d5dp1 (3d5d P:5-150)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2111852Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
    core: three turns of irregular (beta-beta-alpha)n superhelix
  4. 2111853Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) (S)
  5. 2111854Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)
  6. 2111855Protein Ribosomal protein L15 (L15p) [52082] (4 species)
  7. 2111934Species Thermus thermophilus [TaxId:274] [159454] (11 PDB entries)
    Uniprot Q72I23 5-150
  8. 2111938Domain d3d5dp1: 3d5d P:5-150 [157392]
    Other proteins in same PDB: d3d5d61, d3d5d71, d3d5de1, d3d5dh1, d3d5dh2, d3d5dn1, d3d5do1, d3d5du1, d3d5dv1, d3d5dy1, d3d5dz1
    complexed with mg
    complexed with mg

Details for d3d5dp1

PDB Entry: 3d5d (more details), 3.21 Å

PDB Description: Structural basis for translation termination on the 70S ribosome. This file contains the 50S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes as described in remark 400.
PDB Compounds: (P:) 50S ribosomal protein L15

SCOPe Domain Sequences for d3d5dp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d5dp1 c.12.1.1 (P:5-150) Ribosomal protein L15 (L15p) {Thermus thermophilus [TaxId: 274]}
dlrpnpgankrrkrvgrgpgsghgktatrghkgqksrsgglkdprrfeggrsttlmrlpk
rgmqgqvpgeikrpryqgvnlkdlarfegevtpellvragllkkgyrlkilgegeakplk
vvahafsksaleklkaaggepvllea

SCOPe Domain Coordinates for d3d5dp1:

Click to download the PDB-style file with coordinates for d3d5dp1.
(The format of our PDB-style files is described here.)

Timeline for d3d5dp1: