Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.141: Ribosomal protein L6 [56052] (1 superfamily) consists of two beta-sheets and one alpha-helix packed around single core |
Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) automatically mapped to Pfam PF00347 |
Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein) |
Protein Ribosomal protein L6 [56055] (6 species) duplication: consists of two domains of this fold |
Species Thermus thermophilus [TaxId:274] [160797] (15 PDB entries) Uniprot Q72I19 11-81! Uniprot Q72I19 82-170 |
Domain d3d5dh2: 3d5d H:83-170 [157389] Other proteins in same PDB: d3d5d61, d3d5d71, d3d5de1, d3d5dn1, d3d5do1, d3d5dp1, d3d5du1, d3d5dv1, d3d5dy1, d3d5dz1 automatically matched to 2J01 H:83-171 complexed with mg |
PDB Entry: 3d5d (more details), 3.21 Å
SCOPe Domain Sequences for d3d5dh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d5dh2 d.141.1.1 (H:83-170) Ribosomal protein L6 {Thermus thermophilus [TaxId: 274]} yskellikgigyrarlvgraleltvgfshpvvveppegitfevpeptrvrvsgidkqkvg qvaanirairkpsayhekgiyyagepvr
Timeline for d3d5dh2: