Lineage for d3d5d71 (3d5d 7:1-48)

  1. Root: SCOPe 2.07
  2. 2650239Class j: Peptides [58231] (148 folds)
  3. 2652055Fold j.118: Ribosomal protein L34p [144320] (1 superfamily)
    non-globular, mainly alpha-helical
  4. 2652056Superfamily j.118.1: Ribosomal protein L34p [144321] (1 family) (S)
  5. 2652057Family j.118.1.1: Ribosomal protein L34p [144322] (1 protein)
    Pfam PF00468
  6. 2652058Protein Ribosomal protein L34p [144323] (3 species)
  7. 2652075Species Thermus thermophilus [TaxId:274] [161306] (15 PDB entries)
    Uniprot P80340 1-49
  8. 2652079Domain d3d5d71: 3d5d 7:1-48 [157386]
    Other proteins in same PDB: d3d5d61, d3d5de1, d3d5dh1, d3d5dh2, d3d5dn1, d3d5do1, d3d5dp1, d3d5du1, d3d5dv1, d3d5dy1, d3d5dz1
    complexed with mg
    complexed with mg

Details for d3d5d71

PDB Entry: 3d5d (more details), 3.21 Å

PDB Description: Structural basis for translation termination on the 70S ribosome. This file contains the 50S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes as described in remark 400.
PDB Compounds: (7:) 50S ribosomal protein L34

SCOPe Domain Sequences for d3d5d71:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d5d71 j.118.1.1 (7:1-48) Ribosomal protein L34p {Thermus thermophilus [TaxId: 274]}
mkrtwqpnrrkrakthgfrarmrtpggrkvlkrrrqkgrwrltpavrk

SCOPe Domain Coordinates for d3d5d71:

Click to download the PDB-style file with coordinates for d3d5d71.
(The format of our PDB-style files is described here.)

Timeline for d3d5d71: