SCOPe 2.03: Domain d3d5d71: 3d5d 7:1-48

Lineage for d3d5d71 (3d5d 7:1-48)

1. Root: SCOPe 2.03

2. Class j: Peptides [58231] (120 folds)

3. Fold j.118: Ribosomal protein L34p [144320] (1 superfamily)
   non-globular, mainly alpha-helical

4. Superfamily j.118.1: Ribosomal protein L34p [144321] (1 family)

5. Family j.118.1.1: Ribosomal protein L34p [144322] (1 protein)
   Pfam PF00468

6. Protein Ribosomal protein L34p [144323] (3 species)

7. Species Thermus thermophilus [TaxId:274] [161306] (15 PDB entries)
   Uniprot P80340 1-49

8. Domain d3d5d71: 3d5d 7:1-48 [157386]
   Other proteins in same PDB: d3d5d61, d3d5de1, d3d5dh1, d3d5dh2, d3d5dn1, d3d5do1, d3d5dp1, d3d5du1, d3d5dv1, d3d5dy1, d3d5dz1
   automatically matched to 2J01 7:1-49
   complexed with mg

Details for d3d5d71

PDB Entry: 3d5d, 3.21 Å

PDB Description: Structural basis for translation termination on the 70S ribosome. This file contains the 50S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes as described in remark 400.

PDB Compounds: (7:) 50S ribosomal protein L34

SCOPe Domain Sequences for d3d5d71:

Sequence; same for both SEQRES and ATOM records:

>d3d5d71 j.118.1.1 (7:1-48) Ribosomal protein L34p {Thermus thermophilus [TaxId: 274]}
mkrtwqpnrrkrakthgfrarmrtpggrkvlkrrrqkgrwrltpavrk

Timeline for d3d5d71:

• d3d5d71 first appeared in SCOP 1.75
  
• d3d5d71 appears in SCOPe 2.02
  
• d3d5d71 appears in SCOPe 2.04
  
• d3d5d71 appears in the current release, SCOPe 2.08