![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) ![]() |
![]() | Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein) |
![]() | Protein Ribosomal protein S18 [46913] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [46914] (47 PDB entries) Uniprot P80382 |
![]() | Domain d3d5cr1: 3d5c R:19-88 [157381] Other proteins in same PDB: d3d5cb1, d3d5cd1, d3d5ce1, d3d5cf1, d3d5cg1, d3d5ch1, d3d5ci1, d3d5cj1, d3d5ck1, d3d5cl1, d3d5cn1, d3d5co1, d3d5cp1, d3d5cq1, d3d5cs1, d3d5ct1, d3d5cu1 automatically matched to d2j00r1 complexed with mg, zn |
PDB Entry: 3d5c (more details), 3.21 Å
SCOPe Domain Sequences for d3d5cr1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d5cr1 a.4.8.1 (R:19-88) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]} kakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsakeqrilaktikrarilgl lpfteklvrk
Timeline for d3d5cr1: