![]() | Class i: Low resolution protein structures [58117] (26 folds) |
![]() | Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
![]() | Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
![]() | Family i.1.1.1: Ribosome complexes [58120] (1 protein) |
![]() | Protein 70S ribosome functional complex [58121] (9 species) |
![]() | Species Thermus thermophilus [TaxId:274] [58122] (21 PDB entries) |
![]() | Domain d3d5cp1: 3d5c P:1-83 [157379] Other proteins in same PDB: d3d5cb1, d3d5cd1, d3d5ce1, d3d5cf1, d3d5cg1, d3d5ch1, d3d5ci1, d3d5cj1, d3d5ck1, d3d5cn1, d3d5cq1, d3d5cr1, d3d5ct1, d3d5cu1 automatically matched to d1ibkp_ complexed with mg, zn |
PDB Entry: 3d5c (more details), 3.21 Å
SCOP Domain Sequences for d3d5cp1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d5cp1 i.1.1.1 (P:1-83) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]} mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl svgaqptdtarrllrqagvfrqe
Timeline for d3d5cp1: