Lineage for d3d5ck1 (3d5c K:11-126)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1374905Superfamily c.55.4: Translational machinery components [53137] (2 families) (S)
  5. 1374906Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 1374996Protein Ribosomal protein S11 [53141] (2 species)
  7. 1375022Species Thermus thermophilus [TaxId:274] [53142] (46 PDB entries)
    Uniprot P80376
  8. 1375045Domain d3d5ck1: 3d5c K:11-126 [157375]
    Other proteins in same PDB: d3d5cb1, d3d5cd1, d3d5ce1, d3d5cf1, d3d5cg1, d3d5ch1, d3d5ci1, d3d5cj1, d3d5cl1, d3d5cn1, d3d5co1, d3d5cp1, d3d5cq1, d3d5cr1, d3d5cs1, d3d5ct1, d3d5cu1
    automatically matched to d1i94k_
    complexed with mg, zn

Details for d3d5ck1

PDB Entry: 3d5c (more details), 3.21 Å

PDB Description: Structural basis for translation termination on the 70S ribosome. This file contains the 30S subunit, release factor 1 (RF1), two tRNA, and mRNA molecules of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes as described in remark 400.
PDB Compounds: (K:) 30S ribosomal protein S11

SCOPe Domain Sequences for d3d5ck1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d5ck1 c.55.4.1 (K:11-126) Ribosomal protein S11 {Thermus thermophilus [TaxId: 274]}
krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak
kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfr

SCOPe Domain Coordinates for d3d5ck1:

Click to download the PDB-style file with coordinates for d3d5ck1.
(The format of our PDB-style files is described here.)

Timeline for d3d5ck1: