Lineage for d3d5bz1 (3d5b Z:3-179)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 957115Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily)
    barrel, closed; n=6, S=10; complex topology
  4. 957116Superfamily b.53.1: Ribosomal protein L25-like [50715] (2 families) (S)
  5. 957117Family b.53.1.1: Ribosomal protein L25-like [50716] (2 proteins)
  6. 957152Protein Ribosomal protein TL5 (general stress protein CTC) [63798] (2 species)
    contains additional all-beta (sub)domain in the C-terminal extension
  7. 957164Species Thermus thermophilus [TaxId:274] [63799] (12 PDB entries)
  8. 957169Domain d3d5bz1: 3d5b Z:3-179 [157366]
    Other proteins in same PDB: d3d5b61, d3d5b71, d3d5be1, d3d5bh1, d3d5bh2, d3d5bn1, d3d5bo1, d3d5bp1, d3d5bu1, d3d5bv1, d3d5by1
    automatically matched to 2J01 Z:3-179
    complexed with mg

Details for d3d5bz1

PDB Entry: 3d5b (more details), 3.21 Å

PDB Description: Structural basis for translation termination on the 70S ribosome. This file contains the 50S subunit of one 70S ribosome. The entire crystal structure contains two 70S ribosomes as described in remark 400.
PDB Compounds: (Z:) 50S ribosomal protein L25

SCOPe Domain Sequences for d3d5bz1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d5bz1 b.53.1.1 (Z:3-179) Ribosomal protein TL5 (general stress protein CTC) {Thermus thermophilus [TaxId: 274]}
yrlkayyregekpsalrragklpgvmynrhlnrkvyvdlvefdkvfrqasihhvivlelp
dgqslptlvrqvnldkrrrrpehvdffvlsdepvemyvplrfvgtpagvraggvlqeihr
dilvkvsprnipefievdvsgleigdslhasdlklppgvelavspeetiaavvpped

SCOPe Domain Coordinates for d3d5bz1:

Click to download the PDB-style file with coordinates for d3d5bz1.
(The format of our PDB-style files is described here.)

Timeline for d3d5bz1: