| Class b: All beta proteins [48724] (176 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) ![]() many known members contain KOW motif |
| Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins) |
| Protein Ribosomal proteins L24 (L24p) [50106] (4 species) |
| Species Thermus thermophilus [TaxId:274] [159025] (15 PDB entries) Uniprot Q72I15 2-102 |
| Domain d3d5by1: 3d5b Y:2-101 [157365] Other proteins in same PDB: d3d5b61, d3d5b71, d3d5be1, d3d5bh1, d3d5bh2, d3d5bn1, d3d5bo1, d3d5bp1, d3d5bu1, d3d5bv1, d3d5bz1 complexed with mg complexed with mg |
PDB Entry: 3d5b (more details), 3.21 Å
SCOPe Domain Sequences for d3d5by1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d5by1 b.34.5.1 (Y:2-101) Ribosomal proteins L24 (L24p) {Thermus thermophilus [TaxId: 274]}
rvkmhvkkgdtvlvasgkykgrvgkvkevlpkkyavivegvnivkkavrvspkypqggfi
ekeaplhaskvrpicpacgkptrvrkkflengkkirvcak
Timeline for d3d5by1: