Lineage for d3d5by1 (3d5b Y:2-101)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2783937Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. 2783938Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)
  6. 2783981Protein Ribosomal proteins L24 (L24p) [50106] (4 species)
  7. 2784062Species Thermus thermophilus [TaxId:274] [159025] (15 PDB entries)
    Uniprot Q72I15 2-102
  8. 2784065Domain d3d5by1: 3d5b Y:2-101 [157365]
    Other proteins in same PDB: d3d5b61, d3d5b71, d3d5be1, d3d5bh1, d3d5bh2, d3d5bn1, d3d5bo1, d3d5bp1, d3d5bu1, d3d5bv1, d3d5bz1
    complexed with mg
    complexed with mg

Details for d3d5by1

PDB Entry: 3d5b (more details), 3.21 Å

PDB Description: Structural basis for translation termination on the 70S ribosome. This file contains the 50S subunit of one 70S ribosome. The entire crystal structure contains two 70S ribosomes as described in remark 400.
PDB Compounds: (Y:) 50S ribosomal protein L24

SCOPe Domain Sequences for d3d5by1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d5by1 b.34.5.1 (Y:2-101) Ribosomal proteins L24 (L24p) {Thermus thermophilus [TaxId: 274]}
rvkmhvkkgdtvlvasgkykgrvgkvkevlpkkyavivegvnivkkavrvspkypqggfi
ekeaplhaskvrpicpacgkptrvrkkflengkkirvcak

SCOPe Domain Coordinates for d3d5by1:

Click to download the PDB-style file with coordinates for d3d5by1.
(The format of our PDB-style files is described here.)

Timeline for d3d5by1: