Class b: All beta proteins [48724] (174 folds) |
Fold b.155: L21p-like [141090] (1 superfamily) core: sandwich, 6 strands in 2 sheets |
Superfamily b.155.1: L21p-like [141091] (1 family) |
Family b.155.1.1: Ribosomal protein L21p [141092] (1 protein) Pfam PF00829 |
Protein Ribosomal protein L21p [141093] (3 species) |
Species Thermus thermophilus [TaxId:274] [158939] (11 PDB entries) Uniprot P60492 1-101 |
Domain d3d5bv1: 3d5b V:1-101 [157364] Other proteins in same PDB: d3d5b61, d3d5b71, d3d5be1, d3d5bh1, d3d5bh2, d3d5bn1, d3d5bo1, d3d5bp1, d3d5bu1, d3d5by1, d3d5bz1 automatically matched to 2HGJ U:1-101 complexed with mg |
PDB Entry: 3d5b (more details), 3.21 Å
SCOP Domain Sequences for d3d5bv1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d5bv1 b.155.1.1 (V:1-101) Ribosomal protein L21p {Thermus thermophilus [TaxId: 274]} mfaivktggkqyrvepglklrvekldaepgatvelpvlllggektvvgtpvvegasvvae vlghgrgkkilvskfkakvqyrrkkghrqpytellikeirg
Timeline for d3d5bv1: