| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily) core: three turns of irregular (beta-beta-alpha)n superhelix |
Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) ![]() |
| Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins) |
| Protein Ribosomal protein L15 (L15p) [52082] (4 species) |
| Species Thermus thermophilus [TaxId:274] [159454] (11 PDB entries) Uniprot Q72I23 5-150 |
| Domain d3d5bp1: 3d5b P:5-150 [157362] Other proteins in same PDB: d3d5b61, d3d5b71, d3d5be1, d3d5bh1, d3d5bh2, d3d5bn1, d3d5bo1, d3d5bu1, d3d5bv1, d3d5by1, d3d5bz1 complexed with mg complexed with mg |
PDB Entry: 3d5b (more details), 3.21 Å
SCOPe Domain Sequences for d3d5bp1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d5bp1 c.12.1.1 (P:5-150) Ribosomal protein L15 (L15p) {Thermus thermophilus [TaxId: 274]}
dlrpnpgankrrkrvgrgpgsghgktatrghkgqksrsgglkdprrfeggrsttlmrlpk
rgmqgqvpgeikrpryqgvnlkdlarfegevtpellvragllkkgyrlkilgegeakplk
vvahafsksaleklkaaggepvllea
Timeline for d3d5bp1: