| Class b: All beta proteins [48724] (177 folds) |
| Fold b.39: Ribosomal protein L14 [50192] (1 superfamily) barrel, closed; n=5, S=8, meander |
Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) ![]() automatically mapped to Pfam PF00238 |
| Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein) |
| Protein Ribosomal protein L14 [50195] (5 species) |
| Species Thermus thermophilus [TaxId:274] [141308] (13 PDB entries) Uniprot Q5SHP8 1-122 |
| Domain d3d5bo1: 3d5b O:1-122 [157361] Other proteins in same PDB: d3d5b61, d3d5b71, d3d5be1, d3d5bh1, d3d5bh2, d3d5bn1, d3d5bp1, d3d5bu1, d3d5bv1, d3d5by1, d3d5bz1 complexed with mg complexed with mg |
PDB Entry: 3d5b (more details), 3.21 Å
SCOPe Domain Sequences for d3d5bo1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d5bo1 b.39.1.1 (O:1-122) Ribosomal protein L14 {Thermus thermophilus [TaxId: 274]}
miqpqtylevadntgarkimcirvlkgsnakyatvgdvivasvkeaiprgavkegdvvka
vvvrtkkevkrpdgsairfddnaaviinnqleprgtrvfgpvarelrekgfmkivslape
vl
Timeline for d3d5bo1: