Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.21: Ribosomal protein L13 [52160] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family) |
Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein) |
Protein Ribosomal protein L13 [52163] (5 species) synonym: 50S ribosomal protein L13p, HMAL13 |
Species Thermus thermophilus [TaxId:274] [159473] (14 PDB entries) Uniprot P60488 1-139 |
Domain d3d5bn1: 3d5b N:25-161 [157360] Other proteins in same PDB: d3d5b61, d3d5b71, d3d5be1, d3d5bh1, d3d5bh2, d3d5bo1, d3d5bp1, d3d5bu1, d3d5bv1, d3d5by1, d3d5bz1 automatically matched to 2J01 N:1-139 complexed with mg |
PDB Entry: 3d5b (more details), 3.21 Å
SCOPe Domain Sequences for d3d5bn1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d5bn1 c.21.1.1 (N:25-161) Ribosomal protein L13 {Thermus thermophilus [TaxId: 274]} ktyvpkqveprwvlidaegktlgrlatkiatllrgkhrpdwtpnvamgdfvvvvnadkir vtgkkleqkiytrysgypgglkkiplekmlathpervlehavkgmlpkgplgrrlfkrlk vyagpdhphqaqrpekl
Timeline for d3d5bn1: