Lineage for d3d5bn1 (3d5b N:25-161)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855226Fold c.21: Ribosomal protein L13 [52160] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214
  4. 2855227Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family) (S)
  5. 2855228Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein)
  6. 2855229Protein Ribosomal protein L13 [52163] (5 species)
    synonym: 50S ribosomal protein L13p, HMAL13
  7. 2855310Species Thermus thermophilus [TaxId:274] [159473] (14 PDB entries)
    Uniprot P60488 1-139
  8. 2855313Domain d3d5bn1: 3d5b N:25-161 [157360]
    Other proteins in same PDB: d3d5b61, d3d5b71, d3d5be1, d3d5bh1, d3d5bh2, d3d5bo1, d3d5bp1, d3d5bu1, d3d5bv1, d3d5by1, d3d5bz1
    complexed with mg
    complexed with mg

Details for d3d5bn1

PDB Entry: 3d5b (more details), 3.21 Å

PDB Description: Structural basis for translation termination on the 70S ribosome. This file contains the 50S subunit of one 70S ribosome. The entire crystal structure contains two 70S ribosomes as described in remark 400.
PDB Compounds: (N:) 50S ribosomal protein L13

SCOPe Domain Sequences for d3d5bn1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d5bn1 c.21.1.1 (N:25-161) Ribosomal protein L13 {Thermus thermophilus [TaxId: 274]}
ktyvpkqveprwvlidaegktlgrlatkiatllrgkhrpdwtpnvamgdfvvvvnadkir
vtgkkleqkiytrysgypgglkkiplekmlathpervlehavkgmlpkgplgrrlfkrlk
vyagpdhphqaqrpekl

SCOPe Domain Coordinates for d3d5bn1:

Click to download the PDB-style file with coordinates for d3d5bn1.
(The format of our PDB-style files is described here.)

Timeline for d3d5bn1: