Lineage for d1isbb1 (1isb B:1-82)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 44819Fold a.2: Long alpha-hairpin [46556] (11 superfamilies)
  4. 44907Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) (S)
  5. 44908Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)
  6. 44928Protein Fe superoxide dismutase (FeSOD) [46611] (6 species)
  7. 44941Species Escherichia coli [TaxId:562] [46614] (3 PDB entries)
  8. 44947Domain d1isbb1: 1isb B:1-82 [15736]
    Other proteins in same PDB: d1isba2, d1isbb2

Details for d1isbb1

PDB Entry: 1isb (more details), 1.85 Å

PDB Description: structure-function in e. coli iron superoxide dismutase: comparisons with the manganese enzyme from t. thermophilus

SCOP Domain Sequences for d1isbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1isbb1 a.2.11.1 (B:1-82) Fe superoxide dismutase (FeSOD) {Escherichia coli}
sfelpalpyakdalaphisaetieyhygkhhqtyvtnlnnlikgtafegksleeiirsse
ggvfnnaaqvwnhtfywnclap

SCOP Domain Coordinates for d1isbb1:

Click to download the PDB-style file with coordinates for d1isbb1.
(The format of our PDB-style files is described here.)

Timeline for d1isbb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1isbb2